Search illustrations...
Custom work
  • All
  • Photos
  • Illustrations
  • Designs
  • Collections
  • Contributors

bilateral

symmetryandersondesignwesinteriorcalmpastelwhimsicalsymmetricalfluorescent
Iznik Erdogan
Iznik Erdogan
Tulip and carnation botanical tile panel — bilateral symmetry, cobalt ground
Alphonse Aurelia
Alphonse Aurelia
Morning Glory Portrait Medallion
Alphonse Aurelia
Alphonse Aurelia
Sun Personified
Alphonse Aurelia
Alphonse Aurelia
Autumn Allegory
Fleur de Mille
Fleur de Mille
Unicorn and Lion Flanking Heraldic Shield
Fleur de Mille
Fleur de Mille
Central Oak with Birds on Millefleur
Alphonse Aurelia
Alphonse Aurelia
Four Seasons Quadrant
Iznik Erdogan
Iznik Erdogan
Single carnation spray panel — cobalt stem, coral flower head, white ground
Iznik Erdogan
Iznik Erdogan
Lotus and tulip combination panel — the lotus borrowed into Ottoman vocabulary
Iznik Erdogan
Iznik Erdogan
Four-tile cross repeat — tulip center, carnation at each quadrant, saz-leaf fill
Iznik Erdogan
Iznik Erdogan
Large medallion tile — central starburst ringed by alternating tulip and carnati
Iznik Erdogan
Iznik Erdogan
Diagonal lattice tile with flowering branches filling each diamond compartment
Iznik Erdogan
Iznik Erdogan
Horizontal border strip — saz-leaf scroll, tulip heads at regular intervals, cor
Iznik Erdogan
Iznik Erdogan
Arabesque medallion with saz-leaf tendrils radiating to all four corners
Iznik Erdogan
Iznik Erdogan
Trefoil-arch prayer niche tile — floral canopy overhead, geometric base panel
Iznik Erdogan
Iznik Erdogan
Floor tile grid — alternating cobalt and white tiles with tulip inlay at each ju
Iznik Erdogan
Iznik Erdogan
Border frieze detail — rolling wave of tulip buds and leaves, white on cobalt
Iznik Erdogan
Iznik Erdogan
Repeating interlocking star and cross pattern with floral fill in each star
Iznik Erdogan
Iznik Erdogan
Repeating tile wall detail from a mosque interior — offset panels, bold coral tu
Iznik Erdogan
Iznik Erdogan
Vessel panel — slender-necked vase with bouquet of mixed Iznik flowers sprouting
Iznik Erdogan
Iznik Erdogan
Stylized cloud band motif with tulips growing through it — continuous repeat str
Iznik Erdogan
Iznik Erdogan
Four-petal rosette repeat tile — each petal a different floral motif in the same
Alphonse Aurelia
Alphonse Aurelia
Iris Entanglement
Fleur de Mille
Fleur de Mille
Sense of Touch: Lady and Greyhound
Tulip and carnation botanical tile panel — bilateral symmetry, cobalt ground
Autumn Allegory
Central Oak with Birds on Millefleur
Single carnation spray panel — cobalt stem, coral flower head, white ground
Four-tile cross repeat — tulip center, carnation at each quadrant, saz-leaf fill
Diagonal lattice tile with flowering branches filling each diamond compartment
Arabesque medallion with saz-leaf tendrils radiating to all four corners
Floor tile grid — alternating cobalt and white tiles with tulip inlay at each ju
Border frieze detail — rolling wave of tulip buds and leaves, white on cobalt
Repeating tile wall detail from a mosque interior — offset panels, bold coral tu
Stylized cloud band motif with tulips growing through it — continuous repeat str
Four-petal rosette repeat tile — each petal a different floral motif in the same
Sense of Touch: Lady and Greyhound
Morning Glory Portrait Medallion
Sun Personified
Unicorn and Lion Flanking Heraldic Shield
Four Seasons Quadrant
Lotus and tulip combination panel — the lotus borrowed into Ottoman vocabulary
Large medallion tile — central starburst ringed by alternating tulip and carnati
Horizontal border strip — saz-leaf scroll, tulip heads at regular intervals, cor
Trefoil-arch prayer niche tile — floral canopy overhead, geometric base panel
Repeating interlocking star and cross pattern with floral fill in each star
Vessel panel — slender-necked vase with bouquet of mixed Iznik flowers sprouting
Iris Entanglement
Tulip and carnation botanical tile panel — bilateral symmetry, cobalt ground
Iznik Erdogan
Iznik Erdogan
Morning Glory Portrait Medallion
Alphonse Aurelia
Alphonse Aurelia
Sun Personified
Alphonse Aurelia
Alphonse Aurelia
Autumn Allegory
Alphonse Aurelia
Alphonse Aurelia
Unicorn and Lion Flanking Heraldic Shield
Fleur de Mille
Fleur de Mille
Central Oak with Birds on Millefleur
Fleur de Mille
Fleur de Mille
Four Seasons Quadrant
Alphonse Aurelia
Alphonse Aurelia
Single carnation spray panel — cobalt stem, coral flower head, white ground
Iznik Erdogan
Iznik Erdogan
Lotus and tulip combination panel — the lotus borrowed into Ottoman vocabulary
Iznik Erdogan
Iznik Erdogan
Four-tile cross repeat — tulip center, carnation at each quadrant, saz-leaf fill
Iznik Erdogan
Iznik Erdogan
Large medallion tile — central starburst ringed by alternating tulip and carnati
Iznik Erdogan
Iznik Erdogan
Diagonal lattice tile with flowering branches filling each diamond compartment
Iznik Erdogan
Iznik Erdogan
Horizontal border strip — saz-leaf scroll, tulip heads at regular intervals, cor
Iznik Erdogan
Iznik Erdogan
Arabesque medallion with saz-leaf tendrils radiating to all four corners
Iznik Erdogan
Iznik Erdogan
Trefoil-arch prayer niche tile — floral canopy overhead, geometric base panel
Iznik Erdogan
Iznik Erdogan
Floor tile grid — alternating cobalt and white tiles with tulip inlay at each ju
Iznik Erdogan
Iznik Erdogan
Border frieze detail — rolling wave of tulip buds and leaves, white on cobalt
Iznik Erdogan
Iznik Erdogan
Repeating interlocking star and cross pattern with floral fill in each star
Iznik Erdogan
Iznik Erdogan
Repeating tile wall detail from a mosque interior — offset panels, bold coral tu
Iznik Erdogan
Iznik Erdogan
Vessel panel — slender-necked vase with bouquet of mixed Iznik flowers sprouting
Iznik Erdogan
Iznik Erdogan
Stylized cloud band motif with tulips growing through it — continuous repeat str
Iznik Erdogan
Iznik Erdogan
Four-petal rosette repeat tile — each petal a different floral motif in the same
Iznik Erdogan
Iznik Erdogan
Iris Entanglement
Alphonse Aurelia
Alphonse Aurelia
Sense of Touch: Lady and Greyhound
Fleur de Mille
Fleur de Mille

Refine with AI

Browse

  • Images
  • Illustrations
  • Designs
  • Explore
  • Contributors
  • AI Models

Create

  • Custom work
  • Create
  • For game devs

Resources

  • Blog
  • Developers
  • Docs
  • Apps & Integrations

Company

  • About
  • License
  • Terms
  • Privacy
  • Help & Contact
Available on the
Chrome Web Store

© 2026 OKSLOP. Machine made, always fresh, ok quality.

System operational